PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G05440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 190aa    MW: 21012.2 Da    PI: 6.2711
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G05440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.34.4e-30100158159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh 
  OGLUM05G05440.1 100 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCSVKKRVERDREDHRYVITTYDGVHNHA 158
                      59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-3288160IPR003657WRKY domain
SuperFamilySSF1182901.96E-2792160IPR003657WRKY domain
PROSITE profilePS5081131.29595160IPR003657WRKY domain
SMARTSM007747.6E-34100159IPR003657WRKY domain
PfamPF031062.5E-23101157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MAASVGLNPE AFFFSNSYSY SSSPFMASYT PELSAAAIDA DLFSGELDFD CSLPAPAFAG  60
ARQEYPENEN TMMRYESEEK MRARVNGRIG FRTRSEVEIL DDGFKWRKYG KKAVKNSPNP  120
RNYYRCSTEG CSVKKRVERD REDHRYVITT YDGVHNHASP AAAAGDYYSP PLSSAGSPPA  180
AYSAGGSLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2786161378Probable WRKY transcription factor 4
2lex_A7e-2786161378Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0662520.0AK066252.1 Oryza sativa Japonica Group cDNA clone:J013052M10, full insert sequence.
GenBankCT8328020.0CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence.
GenBankHQ8588750.0HQ858875.1 Oryza sativa Japonica Group isolate UT1752 WRKY transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638018.11e-110PREDICTED: probable WRKY transcription factor 50
TrEMBLA0A0D9ZV041e-139A0A0D9ZV04_9ORYZ; Uncharacterized protein
STRINGORGLA05G0050000.11e-115(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-40WRKY DNA-binding protein 50